MAGEA10 anticorps (Middle Region)

N° du produit ABIN632494

Cet anticorps Lapin Polyclonal détecte spécifiquement MAGEA10 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour MAGEA10 anticorps (Middle Region) (ABIN632494)

Antigène: MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGEA10 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAGEA10 anticorps

Épitope: Middle Region

Specificité: MAGEA10 antibody was raised against the middle region of MAGEA10

Purification: Affinity purified

Immunogène: MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAGEA10 Blocking Peptide, (ABIN5614630), is also available for use as a blocking control in assays to test for specificity of this MAGEA10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGEA10

Antigène: MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))

Autre désignation: MAGEA10

Sujet: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other.

Poids moléculaire: 41 kDa (MW of target protein)